PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007757
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 294aa    MW: 32287.9 Da    PI: 8.0216
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-41552PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.6e-14116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
        Lsa007757 116 PWTEDEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 160
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.7131124IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.406109165IPR017930Myb domain
SuperFamilySSF466891.35E-16111166IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-17112163IPR006447Myb domain, plants
SMARTSM007177.6E-10113163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-10115160IPR009057Homeodomain-like
PfamPF002495.6E-11116160IPR001005SANT/Myb domain
CDDcd001675.68E-9116161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSQLQSQSHC CTQCGSNGHD SRSCLTAADD SSSDVSGIGA GEIMLFGVRV KVDPMRKSVS  60
MNNLSQYEHP ATRESSNNNI DVSAAVAVAA DTGYASADDA VRNQSNGSRE RKRGVPWTED  120
EHKLFLLGLQ KVGKGDWRGI SRNFVKTRTP TQVASHAQKY FLRRSNLNRR RRRSSLFDIT  180
TDSVAVMQTE EQQVHDVEKT QAVVQPSIPS SMTVSPVHFE NQVNNGSMLL IRSIPVFPTP  240
NPSTMVDLNL NQKYETSPLP VSLNLSLSFD HNHNQSSYQV ISGFNTGDGM ISVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760664.11e-84PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B09e-84MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A103XXY01e-116A0A103XXY0_CYNCS; Homeodomain-like protein
STRINGPGSC0003DMT4000830323e-80(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.29e-51MYB_related family protein